Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118)

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Persephin MAb (Clone 275508)
MAB2388-SP 25 µg

Human Persephin MAb (Clone 275508)

Sign In for Pricing
View Details
CD57 (HNK-1) Mouse Monoclonal Antibody (Alexa Fluor® 647 Conjugate)
CST 40584S 200 µL

CD57 (HNK-1) Mouse Monoclonal Antibody (Alexa Fluor® 647 Conjugate)

Sign In for Pricing
View Details
ASMTL-AS1 Human shRNA Plasmid Kit (Locus ID 80161)
TL305145 1 Kit

ASMTL-AS1 Human shRNA Plasmid Kit (Locus ID 80161)

Sign In for Pricing
View Details
Rabbit Complement C1q like protein 4 (C1QL4) ELISA kit
GTR10393867 96 Well

Rabbit Complement C1q like protein 4 (C1QL4) ELISA kit

Sign In for Pricing
View Details
X77
MBS5825358 Inquire

X77

Sign In for Pricing
View Details
Human Succinate Receptor 1 (SUCNR1) ELISA Kit
201-12-5006 96 Tests

Human Succinate Receptor 1 (SUCNR1) ELISA Kit

Sign In for Pricing
View Details