Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118)

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100040546 shRNA Plasmid (m)
sc-147356-SH 20 µg

LOC100040546 shRNA Plasmid (m)

Sign In for Pricing
View Details
Rcor3 (NM_001134985) Rat Tagged ORF Clone Lentiviral Particle
RR202927L4V 200 µL

Rcor3 (NM_001134985) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
UCMA Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-12378R-PE-Cy5.5 100 µL

UCMA Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rat Fam193a Pre-designed siRNA Set A
SI204789A 1 Each

Rat Fam193a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Filter, Disk, GE, PCTE, PVPF, 5.0μm, 8"X10", 30/Pk
1225120 30 Pieces/Case:1 Piece/ PACKS:30 PACKS/CASE

Filter, Disk, GE, PCTE, PVPF, 5.0μm, 8"X10", 30/Pk

Sign In for Pricing
View Details
Canine Glia Maturation Factor Beta ELISA Kit
MBS006944-01 48 Well

Canine Glia Maturation Factor Beta ELISA Kit

Sign In for Pricing
View Details