Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118)

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL28 Antibody
A41789-50UL 50 μL

MRPL28 Antibody

Sign In for Pricing
View Details
Anti-EDNRB Antibody Picoband®, iFluor647 Conjugate
A01041-iFluor647 100 µg

Anti-EDNRB Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF640R conjugate, 0.1mg/mL
BNC401237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EXOSC7 (NM_015004) Human Recombinant Protein
E45H41435M5 20 µg

EXOSC7 (NM_015004) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Chenopodium rubrum Small heat shock protein, chloroplastic (HSP23), partial
MBS1118062 Inquire

Recombinant Chenopodium rubrum Small heat shock protein, chloroplastic (HSP23), partial

Sign In for Pricing
View Details
Mxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3972007 1.0 µg DNA

Mxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details