Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-28-5p miRNA Antagomir
MBS8320504-01 10 nmol

rno-miR-28-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-28-5p miRNA Antagomir
MBS8320504-02 20 nmol

rno-miR-28-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-28-5p miRNA Antagomir
MBS8320504-03 5x 20 nmol

rno-miR-28-5p miRNA Antagomir

Sign In for Pricing
View Details
NPPA Rabbit pAb
E45R22677N-100 100 µL

NPPA Rabbit pAb

Sign In for Pricing
View Details
ARNT2 Human shRNA Plasmid Kit (Locus ID 9915)
TR314657 1 Kit

ARNT2 Human shRNA Plasmid Kit (Locus ID 9915)

Sign In for Pricing
View Details
3,4-Dihydro-2H-benzo[b]oxepin-5-one
OR918393-01 250 mg

3,4-Dihydro-2H-benzo[b]oxepin-5-one

Sign In for Pricing
View Details