Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124)

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human cytomegalovirus (HCMV) Glycoprotein B / gB Protein (His Tag)
PKSV030208 100 µg

Recombinant Human cytomegalovirus (HCMV) Glycoprotein B / gB Protein (His Tag)

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker), CF640R conjugate, 0.1mg/mL
BNC401657-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]
TA506381BM 100 µL

CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

Sign In for Pricing
View Details
α, ω-Bis-Pyridyldithio PEG
113000-44.5G 5 g

α, ω-Bis-Pyridyldithio PEG

Sign In for Pricing
View Details
Vonoprazan Fumarate-D3
TRC-V767012-5MG 5 mg

Vonoprazan Fumarate-D3

Sign In for Pricing
View Details
POFUT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H1]
TA505004AM 100 µL

POFUT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H1]

Sign In for Pricing
View Details