Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124)

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human VIM (Vimentin) ELISA Kit
E-UNEL-H0010-01 5x 96 Tests

Uncoated Human VIM (Vimentin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human VIM (Vimentin) ELISA Kit
E-UNEL-H0010-02 15x 96 Tests

Uncoated Human VIM (Vimentin) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS702840 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
HBA-T2 (HBB) (NM_000518) Human Over-expression Lysate
LY400174 100 µg

HBA-T2 (HBB) (NM_000518) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TET2 activation kit by CRISPRa
GA110262 1 Kit

Human TET2 activation kit by CRISPRa

Sign In for Pricing
View Details
ZBTB8A antibody
FNab09599 100 µg

ZBTB8A antibody

Sign In for Pricing
View Details