Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124)

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LLGL1 Rabbit Polyclonal Antibody
TA378072 100 µL

LLGL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DTX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0636207 1.0 µg DNA

DTX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CSFV E2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4527R-BF647 100 µL

CSFV E2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
βB1-crystallin CRISPR Activation Plasmid (h2)
sc-403361-ACT-2 20 µg

βB1-crystallin CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
LIPN Protein Vector (Human) (pPM-C-HA)
26880021 500 ng

LIPN Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ankra2 (BC066113) Mouse Tagged ORF Clone
MG204255 10 µg

Ankra2 (BC066113) Mouse Tagged ORF Clone

Sign In for Pricing
View Details