Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428)

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps25 (NM_024266) Mouse Tagged ORF Clone
MG200646 10 µg

Rps25 (NM_024266) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human SPEM3 activation kit by CRISPRa
GA119792 1 Kit

Human SPEM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Menaquinone 4(Mixture of cis-trans isomers)
TRC-M218595-25MG 25 mg

Menaquinone 4(Mixture of cis-trans isomers)

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505285 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
AzoDye-2 Alkyne
2434-AAT 1 mg

AzoDye-2 Alkyne

Sign In for Pricing
View Details
Recombinant Rat HepaCAM2 Protein (His Tag)
PKSR030294 100 µg

Recombinant Rat HepaCAM2 Protein (His Tag)

Sign In for Pricing
View Details