Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARPT discontinued
540739-01 30ul

PARPT discontinued

Sign In for Pricing
View Details
PARPT discontinued
540739-02 100 µL

PARPT discontinued

Sign In for Pricing
View Details
3'-Chloro-2,2,2,4'-tetrafluoroacetophenone
sc-335894 1 g

3'-Chloro-2,2,2,4'-tetrafluoroacetophenone

Sign In for Pricing
View Details
Mouse Monoclonal CD23/Fc epsilon RII Antibody (138628) [HRP]
FAB123H 0.5 mL

Mouse Monoclonal CD23/Fc epsilon RII Antibody (138628) [HRP]

Sign In for Pricing
View Details
CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone Lentiviral Particle
RC230406L3V 200 µL

CPXM (CPXM1) (NM_001184699) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-RHBDL2 antibody
PAab07278 100 µg

Anti-RHBDL2 antibody

Sign In for Pricing
View Details