Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heme oxygenase 2 (HMOX2) (NM_001127205) Human Recombinant Protein
TP325452 20 µg

Heme oxygenase 2 (HMOX2) (NM_001127205) Human Recombinant Protein

Sign In for Pricing
View Details
Human ACTG2 knockdown cell line
ABC-KD0204 1 Vial

Human ACTG2 knockdown cell line

Sign In for Pricing
View Details
Mal-PEG3-COOH
MD141016-3 1 g

Mal-PEG3-COOH

Sign In for Pricing
View Details
Recombinant Human DCX Protein
E30P1936 20 µg

Recombinant Human DCX Protein

Sign In for Pricing
View Details
MC1 Receptor monoclonal antibody
orb1677087-01 50 µL

MC1 Receptor monoclonal antibody

Sign In for Pricing
View Details
MC1 Receptor monoclonal antibody
orb1677087-02 100 µL

MC1 Receptor monoclonal antibody

Sign In for Pricing
View Details