Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLIP Antibody
6719-002mg 0.02 mg

MLIP Antibody

Sign In for Pricing
View Details
Gdf5 AAV siRNA Pooled Vector
21419164 1.0 µg

Gdf5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NMT2 Rabbit pAb, BF700 conjugated
orb2877795 100 µL

NMT2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Uridine-cytidine Kinase 2 (UCK2) Mouse ELISA Kit
I1545 96 Tests

Uridine-cytidine Kinase 2 (UCK2) Mouse ELISA Kit

Sign In for Pricing
View Details
OAEC00311-50UG - ABL1/2 Antibody (Phospho-Tyr393/429)
OAEC00311-50UG 50 µg

OAEC00311-50UG - ABL1/2 Antibody (Phospho-Tyr393/429)

Sign In for Pricing
View Details
CHP2 Human shRNA Plasmid Kit (Locus ID 63928)
TR317411 1 Kit

CHP2 Human shRNA Plasmid Kit (Locus ID 63928)

Sign In for Pricing
View Details