Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 1,2-Bislauroyl-3-chloropropanediol
TRC-B415550-25MG 25 mg

rac 1,2-Bislauroyl-3-chloropropanediol

Sign In for Pricing
View Details
Nkx2.6 (NKX2-6) Rabbit Polyclonal Antibody
AP01480PU-N 100 µg

Nkx2.6 (NKX2-6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYL7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]
TA800150BM 100 µL

MYL7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details
Thiamine Hydrochloride
TRC-T344185-1G 1 g

Thiamine Hydrochloride

Sign In for Pricing
View Details
SHARP2 Recombinant Rabbit Monoclonal Antibody [PSH01-91]
HA721749 100 µL

SHARP2 Recombinant Rabbit Monoclonal Antibody [PSH01-91]

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL
BNC400717-100 1x 100 µL

CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details