Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat HBEGF ELISA Kit (Ready to Use)
orb549097-01 48 Tests

Rat HBEGF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat HBEGF ELISA Kit (Ready to Use)
orb549097-02 96 Tests

Rat HBEGF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
SULT1B1 (NM_014465) Human Over-expression Lysate
LS027284-20ug 20 µg

SULT1B1 (NM_014465) Human Over-expression Lysate

Sign In for Pricing
View Details
MAGI2 Antibody
A43027-100UG 100 µg

MAGI2 Antibody

Sign In for Pricing
View Details
IFluor® 660 succinimidyl ester
71511-AAT 5 mg

IFluor® 660 succinimidyl ester

Sign In for Pricing
View Details
OXCT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1580007 1.0 µg DNA

OXCT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details