Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158)

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD34 Antibody
RD30531F-01 25 µg

APC Anti-Mouse CD34 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD34 Antibody
RD30531F-02 100 µg

APC Anti-Mouse CD34 Antibody

Sign In for Pricing
View Details
Cnot10 Mouse Gene Knockout Kit (CRISPR)
KN503558 1 Kit

Cnot10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]
TA502939AM 100 µL

STAT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]

Sign In for Pricing
View Details
Zscan29 Mouse Gene Knockout Kit (CRISPR)
KN520155 1 Kit

Zscan29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PD-L1/B7-H1, C-His Tag
HA210954-01 Inquire

Human PD-L1/B7-H1, C-His Tag

Sign In for Pricing
View Details