Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158)

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), 1mg/mL
BNUM1976-50 1x 50 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human TH TYH Protein (Sumo Tag)
PDEH100637-01 20 µg

Recombinant Human TH TYH Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TH TYH Protein (Sumo Tag)
PDEH100637-02 100 µg

Recombinant Human TH TYH Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TH TYH Protein (Sumo Tag)
PDEH100637-03 500 µg

Recombinant Human TH TYH Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TH TYH Protein (Sumo Tag)
PDEH100637-04 1 mg

Recombinant Human TH TYH Protein (Sumo Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505709 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details