Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158)

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL
BNC470045-100 1x 100 µL

Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RTL8B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]
TA502175BM 100 µL

RTL8B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details
2-(Octadecyloxy)ethanol
TRC-O268063-1G 1 g

2-(Octadecyloxy)ethanol

Sign In for Pricing
View Details
NPG Glycol-d6
TRC-N897006-50MG 50 mg

NPG Glycol-d6

Sign In for Pricing
View Details
PI 3 Kinase p85 alpha (PIK3R1) (NM_181504) Human Over-expression Lysate
LC403621 20 µg

PI 3 Kinase p85 alpha (PIK3R1) (NM_181504) Human Over-expression Lysate

Sign In for Pricing
View Details
Rps9 Mouse Gene Knockout Kit (CRISPR)
KN515119 1 Kit

Rps9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details