Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROBO1 Rabbit Polyclonal Antibody
AP05287PU-N 100 µg

ROBO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL32 Human Gene Knockout Kit (CRISPR)
KN205884LP 1 Kit

IL32 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKA R2 (PRKAR2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]
TA501146BM 100 µL

PKA R2 (PRKAR2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]

Sign In for Pricing
View Details
CD1E (NM_001042584) Human Over-expression Lysate
LY420992 100 µg

CD1E (NM_001042584) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem134 (NM_001078649) Mouse Tagged ORF Clone
MG201909 10 µg

Tmem134 (NM_001078649) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Beta-Actin Antibody
KC-959-01 50 μL

Beta-Actin Antibody

Sign In for Pricing
View Details