Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF807517 100 µg

DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (His Tag)
PKSH032417-01 10 µg

Recombinant Human CD32a/FCGR2A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (His Tag)
PKSH032417-02 50 µg

Recombinant Human CD32a/FCGR2A Protein (His Tag)

Sign In for Pricing
View Details
(3S)-Aminoquinuclidine Dihydrochloride
TRC-A629190-5G 5 g

(3S)-Aminoquinuclidine Dihydrochloride

Sign In for Pricing
View Details
MPP3 (C-term) Rabbit Polyclonal Antibody
AP52739PU-N 400 µL

MPP3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sodium Dodecyl Sulfate-d25
TRC-S083920-50MG 50 mg

Sodium Dodecyl Sulfate-d25

Sign In for Pricing
View Details