Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARS Peptide - middle region (AAP58758)
AAP58758-100UG 100 µg

GARS Peptide - middle region (AAP58758)

Sign In for Pricing
View Details
PON2, NT (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)
MBS6335905-01 0.2 mL

PON2, NT (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)

Sign In for Pricing
View Details
PON2, NT (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)
MBS6335905-02 5x 0.2 mL

PON2, NT (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)

Sign In for Pricing
View Details
Anti-SCN11A  (6E1)
YF-MA17706 100 ug

Anti-SCN11A (6E1)

Sign In for Pricing
View Details
FADD shRNA (m) Lentiviral Particles
sc-35351-V 200 µL

FADD shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
IRAK1BP1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-16694R-APC-Cy7 100 µL

IRAK1BP1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details