Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C6orf72 (GINM1) activation kit by CRISPRa
GA114581 1 Kit

Human C6orf72 (GINM1) activation kit by CRISPRa

Sign In for Pricing
View Details
CENPA Recombinant Rabbit monoclonal Antibody
HA750578 100 µL

CENPA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CCDC90B (NM_021825) Human Recombinant Protein
TP313680L 1 mg

CCDC90B (NM_021825) Human Recombinant Protein

Sign In for Pricing
View Details
NAT8B (NM_016347) Human Over-expression Lysate
LC402542 20 µg

NAT8B (NM_016347) Human Over-expression Lysate

Sign In for Pricing
View Details
METTL9 Human Gene Knockout Kit (CRISPR)
KN400028 1 Kit

METTL9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD74 (BU45), 0.2mg/mL
BNUB0189-500 1x 500 µL

CD74 (BU45), 0.2mg/mL

Sign In for Pricing
View Details