Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Oxopipecolic Acid-d4 (Major)
TRC-D758495-50MG 50 mg

6-Oxopipecolic Acid-d4 (Major)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UG-01 25 µg

PE/Cyanine5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UG-02 100 µg

PE/Cyanine5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
IL17B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA811136BM 100 µL

IL17B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
Recombinant Sortilin Antibody
RC-15595-01 50 μL

Recombinant Sortilin Antibody

Sign In for Pricing
View Details
Recombinant Sortilin Antibody
RC-15595-02 100 µL

Recombinant Sortilin Antibody

Sign In for Pricing
View Details