Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54)

This Recombinant Human T cell receptor beta variable 5-4 (TVB54) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW09F-PG/W 10x 96 Well Plates

Protein G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Sodium Acetate 3M, pH 4.5
EC-905 200 mL

Sodium Acetate 3M, pH 4.5

Sign In for Pricing
View Details
MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF568 conjugate, 0.1mg/mL
BNC683159-500 1x 500 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (BSG) Rabbit Polyclonal Antibody
TA364709 100 µL

CD147 (BSG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha 1 Catenin (CTNNA1) pSer641 Rabbit Polyclonal Antibody
AP09467PU-S 50 µL

alpha 1 Catenin (CTNNA1) pSer641 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FECH (NM_001012515) Human Over-expression Lysate
LY422881 100 µg

FECH (NM_001012515) Human Over-expression Lysate

Sign In for Pricing
View Details