Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54)

This Recombinant Human T cell receptor beta variable 5-4 (TVB54) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA (PCNA/694), CF640R conjugate, 0.1mg/mL
BNC400694-100 1x 100 µL

PCNA (PCNA/694), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lipin 2 (LPIN2) (Center) Rabbit Polyclonal Antibody
AP18101PU-N 400 µL

Lipin 2 (LPIN2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Amino-2-[2-(4-heptylphenyl)ethyl]propane-1,3-diol
TRC-A626900-1MG 1 mg

2-Amino-2-[2-(4-heptylphenyl)ethyl]propane-1,3-diol

Sign In for Pricing
View Details
JAK3 Recombinant Rabbit Monoclonal Antibody [JM66-31]
ET1705-1 100 µL

JAK3 Recombinant Rabbit Monoclonal Antibody [JM66-31]

Sign In for Pricing
View Details
PRKX Antibody
8C18601-AAT 50 µg

PRKX Antibody

Sign In for Pricing
View Details
PPP1R14A Rabbit Polyclonal Antibody
AP20739PU-N 100 µg

PPP1R14A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details