Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54)

This Recombinant Human T cell receptor beta variable 5-4 (TVB54) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRCD (NM_001077620) Human Over-expression Lysate
LY421463 100 µg

PRCD (NM_001077620) Human Over-expression Lysate

Sign In for Pricing
View Details
Uridine 5'-Monophosphate
TRC-U830020-250MG 250 mg

Uridine 5'-Monophosphate

Sign In for Pricing
View Details
(3Beta,22E)-Ergosta-5,7,22-triene-3,24,25-triol-d3
TRC-E599192-5MG 5 mg

(3Beta,22E)-Ergosta-5,7,22-triene-3,24,25-triol-d3

Sign In for Pricing
View Details
NLRP7 Rabbit Polyclonal Antibody
TA366969 100 µL

NLRP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS500177 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
CD61 (ITGB3) Rabbit Polyclonal Antibody
TA364494 100 µL

CD61 (ITGB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details