Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D3 (CCND3) (NM_001760) Human Over-expression Lysate
LY400666 100 µg

Cyclin D3 (CCND3) (NM_001760) Human Over-expression Lysate

Sign In for Pricing
View Details
Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody
TA382646 100 µL

Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Orm2 (NM_011016) Mouse Tagged ORF Clone
MG202200 10 µg

Orm2 (NM_011016) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Salivary alpha amylase (AMY1C) Human Gene Knockout Kit (CRISPR)
KN415827 1 Kit

Salivary alpha amylase (AMY1C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS625437 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: sigmoid
CD563359 5 µg

Tissue Genomic DNA, Colon: sigmoid

Sign In for Pricing
View Details