Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-9E3), Biotin conjugate, 0.1mg/mL
BNCB0010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TP53INP2 Antibody
8C11320-AAT 50 µg

TP53INP2 Antibody

Sign In for Pricing
View Details
KIAA0513 (NM_001297766) Human Tagged ORF Clone
RG237313 10 µg

KIAA0513 (NM_001297766) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Amino PEG
12750-2.5G 5 g

Ɑ-Methoxy-ω-Amino PEG

Sign In for Pricing
View Details
Inductively Coupled Plasma Emission Spectrometer BICP-701
BICP-701 1 Unit

Inductively Coupled Plasma Emission Spectrometer BICP-701

Sign In for Pricing
View Details