Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (Autophagy Marker) (UBB/1748), CF405S conjugate, 0.1mg/mL
BNC041748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TP53BP2 (NM_001031685) Human Over-expression Lysate
LC421900 20 µg

TP53BP2 (NM_001031685) Human Over-expression Lysate

Sign In for Pricing
View Details
3-(Diethylphosphono)propanoic acid (Technical Grade)
TRC-D444788-250MG 250 mg

3-(Diethylphosphono)propanoic acid (Technical Grade)

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), 0.2mg/mL
BNUB0053-100 1x 100 µL

HCG-alpha (HCGa/53), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF488A conjugate, 0.1mg/mL
BNC881100-100 1x 100 µL

Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GASK1B (NM_001031700) Human Over-expression Lysate
LY422154 100 µg

GASK1B (NM_001031700) Human Over-expression Lysate

Sign In for Pricing
View Details