Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ANKRD17 Antibody
NB100-86996 100 µL

Rabbit Polyclonal ANKRD17 Antibody

Sign In for Pricing
View Details
LAMB2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
26276156 3x 1.0 µg DNA

LAMB2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
CD95 Mouse Monoclonal Antibody
E38PA8561 100 µL

CD95 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Usp7 (NM_001003918) Mouse Tagged Lenti ORF Clone
MR226803L4 10 µg

Usp7 (NM_001003918) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRPC5 (NM_012471) Human 3' UTR Clone
SC217333 10 µg

TRPC5 (NM_012471) Human 3' UTR Clone

Sign In for Pricing
View Details
Rabbit Polyclonal CLPS Antibody [FITC]
NBP2-99955F 0.1 mL

Rabbit Polyclonal CLPS Antibody [FITC]

Sign In for Pricing
View Details