Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106)

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 2-Azabicyclo[2.2.1]hept-5-en-3-one
TRC-A795200-25G 25 g

rac 2-Azabicyclo[2.2.1]hept-5-en-3-one

Sign In for Pricing
View Details
Human GRAMD1A activation kit by CRISPRa
GA111662 1 Kit

Human GRAMD1A activation kit by CRISPRa

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), 0.2mg/mL
BNUB2946-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human EDEM2/C20orf31 Protein (His Tag)
PKSH030522 100 µg

Recombinant Human EDEM2/C20orf31 Protein (His Tag)

Sign In for Pricing
View Details
(R)-Naproxen Acyl-Beta-D-glucuronide
TRC-N377515-1MG 1 mg

(R)-Naproxen Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details
AKAP12 Antibody
KC-45454-01 50 μL

AKAP12 Antibody

Sign In for Pricing
View Details