Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106)

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG1*
V100010-AAT 50 µg

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG1*

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713842 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Sumo 2+3 Recombinant Rabbit Monoclonal Antibody [JJ087-04]
ET1701-17 100 µL

Sumo 2+3 Recombinant Rabbit Monoclonal Antibody [JJ087-04]

Sign In for Pricing
View Details
CD1b (RIV12), Biotin conjugate, 0.1mg/mL
BNCB0317-500 1x 500 µL

CD1b (RIV12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP6V0D2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]
TA812166BM 100 µL

ATP6V0D2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF488A conjugate, 0.1mg/mL
BNC882831-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details