Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539)

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E Antibody - N-terminal region : FITC (ARP76116_P050-FITC)
ARP76116_P050-FITC 100 µL

EIF4E Antibody - N-terminal region : FITC (ARP76116_P050-FITC)

Sign In for Pricing
View Details
Goat anti-LIP1 / LKB1IP Antibody
orb19999 100 µg

Goat anti-LIP1 / LKB1IP Antibody

Sign In for Pricing
View Details
DMRTA2 HDR Plasmid (m)
sc-433921-HDR 20 µg

DMRTA2 HDR Plasmid (m)

Sign In for Pricing
View Details
DNAH3 sgRNA CRISPR Lentivector set (Human)
K0611401 3x 1.0 µg

DNAH3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Fish Epigen ELISA Kit
MBS055212 Inquire

Fish Epigen ELISA Kit

Sign In for Pricing
View Details
PE anti-human CD40
MBS9471729-01 25 Tests

PE anti-human CD40

Sign In for Pricing
View Details