Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539)

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NKp44/NCR2 Antibody (1G6) [Biotin]
NBP2-42683B 100 µL

Mouse Monoclonal NKp44/NCR2 Antibody (1G6) [Biotin]

Sign In for Pricing
View Details
VPS37C Antibody (Center)
E45M08485G-1 100 µL

VPS37C Antibody (Center)

Sign In for Pricing
View Details
Anti-TMEM107 Antibody Picoband® (PE Conjugate)
A04966-PE 100 µg/Vial

Anti-TMEM107 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
ITGA9 Protein Vector (Human) (pPM-C-HA)
PV021843 500 ng

ITGA9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TECPR2 (NM_001172631) Human Tagged Lenti ORF Clone
RC230687L4 10 µg

TECPR2 (NM_001172631) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cacna1d Mouse shRNA Lentiviral Particle (Locus ID 12289)
TL500243V 500 µL Each

Cacna1d Mouse shRNA Lentiviral Particle (Locus ID 12289)

Sign In for Pricing
View Details