Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539)

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A5 Polyclonal Antibody
ANT-14422-100ug 100 µg

SLC22A5 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC51 siRNA (Mouse)
CRM6752-01 15 nmol

CCDC51 siRNA (Mouse)

Sign In for Pricing
View Details
CCDC51 siRNA (Mouse)
CRM6752-02 30 nmol

CCDC51 siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Hspa12b shRNA (UAS) - Lentiviral mouse Hspa12b shRNA (UAS, iRFP) (25)
GTR15284990 1 Vial

Lentiviral mouse Hspa12b shRNA (UAS) - Lentiviral mouse Hspa12b shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
IgY Antibody
orb433786 0.25 mg

IgY Antibody

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Mouse Monoclonal Antibody [Clone 2D11]
E45M18170V-2 50 µL

G protein alpha 16 (GNA15) Mouse Monoclonal Antibody [Clone 2D11]

Sign In for Pricing
View Details