Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), Biotin conjugate, 0.1mg/mL
BNCB1260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SSX4 (SSX4B) (NM_001040612) Human Over-expression Lysate
LC421777 20 µg

SSX4 (SSX4B) (NM_001040612) Human Over-expression Lysate

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF640R conjugate, 0.1mg/mL
BNC401059-500 1x 500 µL

CD71 (TFRC/1059), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Btbd9 Mouse Gene Knockout Kit (CRISPR)
KN502301 1 Kit

Btbd9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS628078 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Human SAR1B activation kit by CRISPRa
GA109590 1 Kit

Human SAR1B activation kit by CRISPRa

Sign In for Pricing
View Details