Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: A8B5]
AM03059PU-N 100 µg

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: A8B5]

Sign In for Pricing
View Details
TMPyP4
TRC-T460010-250MG 250 mg

TMPyP4

Sign In for Pricing
View Details
Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-R0058-01 24 Tests

Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-R0058-02 48 Tests

Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit
E-CL-R0058-03 96 Tests

Rat AhR (Aryl Hydrocarbon Receptor) CLIA Kit

Sign In for Pricing
View Details
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA367140 100 µL

MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details