Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POMP Antibody
OACD06621-100UL 100 µL

POMP Antibody

Sign In for Pricing
View Details
Rabbit Importin 4 Antibody
orb1526110-01 10 µL

Rabbit Importin 4 Antibody

Sign In for Pricing
View Details
Rabbit Importin 4 Antibody
orb1526110-02 100 µL

Rabbit Importin 4 Antibody

Sign In for Pricing
View Details
MARK2 Blocking Peptide
CBP4079-01 1 mg

MARK2 Blocking Peptide

Sign In for Pricing
View Details
MARK2 Blocking Peptide
CBP4079-02 5 mg

MARK2 Blocking Peptide

Sign In for Pricing
View Details
Rat Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)
MBS2090332-01 5x 96 Tests

Rat Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details