Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D)

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-2-Hydroxy-4-phenylbutyric Acid Ethyl Ester
TRC-H949095-25MG 25 mg

(S)-2-Hydroxy-4-phenylbutyric Acid Ethyl Ester

Sign In for Pricing
View Details
DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®647 Conjugate - Biotium Choice
P038-647-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®647 Conjugate - Biotium Choice

Sign In for Pricing
View Details
MAST4 Antibody
KC-1550-01 50 μL

MAST4 Antibody

Sign In for Pricing
View Details
MAST4 Antibody
KC-1550-02 100 µL

MAST4 Antibody

Sign In for Pricing
View Details
MAST4 Antibody
KC-1550-03 1 mL

MAST4 Antibody

Sign In for Pricing
View Details
Topoisomerase II alpha (TOP2A) (NM_001067) Human Over-expression Lysate
LC420704 20 µg

Topoisomerase II alpha (TOP2A) (NM_001067) Human Over-expression Lysate

Sign In for Pricing
View Details