Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRAILR4/TNFRSF10D/DcR2 Antibody (104918) [PE/Cy5.5]
FAB633PECY55 0.5 mL

Mouse Monoclonal TRAILR4/TNFRSF10D/DcR2 Antibody (104918) [PE/Cy5.5]

Sign In for Pricing
View Details
MMTAG2 Lentiviral Activation Particles (m)
sc-426785-LAC 200 µL

MMTAG2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
C1orf134 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0212907 1.0 µg DNA

C1orf134 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Hsa-miR-4680-3p miRNA Agomir
CMJ1499-01 5 nmol

Hsa-miR-4680-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4680-3p miRNA Agomir
CMJ1499-02 10 nmol

Hsa-miR-4680-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4680-3p miRNA Agomir
CMJ1499-03 20 nmol

Hsa-miR-4680-3p miRNA Agomir

Sign In for Pricing
View Details