Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLR Family Pyrin Domain Containing 7 (NLRP7) Antibody
abx211025-01 50 µL

NLR Family Pyrin Domain Containing 7 (NLRP7) Antibody

Sign In for Pricing
View Details
NLR Family Pyrin Domain Containing 7 (NLRP7) Antibody
abx211025-02 100 µL

NLR Family Pyrin Domain Containing 7 (NLRP7) Antibody

Sign In for Pricing
View Details
Phospho-CTBP1 (Ser422) Antibody Blocking Peptide
orb1515204 500 µg

Phospho-CTBP1 (Ser422) Antibody Blocking Peptide

Sign In for Pricing
View Details
NPHP4 Antibody, FITC conjugated
A29926-50UG 50 µg

NPHP4 Antibody, FITC conjugated

Sign In for Pricing
View Details
HR based Kit in Mouse Neuronal Cells Requiring I-Sce1 Transfection (50ug DNA)
DR3000 HRCN1.4-Sce 1 Each

HR based Kit in Mouse Neuronal Cells Requiring I-Sce1 Transfection (50ug DNA)

Sign In for Pricing
View Details
ACTA1/alpha-actin Antibody (C-term)
E45R04217G-1 100 µL

ACTA1/alpha-actin Antibody (C-term)

Sign In for Pricing
View Details