Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7P8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1889405 3x 1.0 µg

RPL7P8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
INSYN2A (NM_001039762) Human Tagged ORF Clone
RC218717 10 µg

INSYN2A (NM_001039762) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Exosome component 7 Antibody [PE]
NBP2-97525PE 0.1 mL

Rabbit Polyclonal Exosome component 7 Antibody [PE]

Sign In for Pricing
View Details
NHE6 Antibody
E38PA2488 100 µL

NHE6 Antibody

Sign In for Pricing
View Details
MS4A2 (NM_000139) Human Untagged Clone
SC300015 10 µg

MS4A2 (NM_000139) Human Untagged Clone

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)
MBS2124998-01 0.1 mL

APC-Linked Polyclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)

Sign In for Pricing
View Details