Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1)

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sec16a activation kit by CRISPRa
GA213951 1 Kit

Mouse Sec16a activation kit by CRISPRa

Sign In for Pricing
View Details
Slc35e2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
44143116 3x 1.0 µg

Slc35e2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human N4BP3 Protein
E30P7523 20 µg

Recombinant Human N4BP3 Protein

Sign In for Pricing
View Details
Caspase 9 (1D1)  monoclonal antibody
MB3050 50ul

Caspase 9 (1D1) monoclonal antibody

Sign In for Pricing
View Details
NCALD (NM_001040629) Human Recombinant Protein
TP318434L 1 mg

NCALD (NM_001040629) Human Recombinant Protein

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) Low Glucose, w/o Amino Acids, Pyruvic Acid
PG032 4X 500ml bottle

Dulbecco’s MEM (DMEM) Low Glucose, w/o Amino Acids, Pyruvic Acid

Sign In for Pricing
View Details