Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62)

This Recombinant Human T cell receptor beta variable 6-2 (TVB62) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-Human CD49f, FITC Conjugated mAb.
E16HF0491-050 50 Tests

Mouse anti-Human CD49f, FITC Conjugated mAb.

Sign In for Pricing
View Details
TRPV3 ORF Vector (Human) (pORF)
48532011 1.0 µg DNA

TRPV3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human SMIM15 shRNA (UAS) - Lentiviral human SMIM15 shRNA (UAS) (100)
GTR15082278 1 Vial

Lentiviral human SMIM15 shRNA (UAS) - Lentiviral human SMIM15 shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-Zebrafish eif4eb Antibody Fluoro594 Conjugated
DZ41678-Fluoro594 200 µL/Vial

Anti-Zebrafish eif4eb Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
Positive Control Lysate for anti- CD80 antibody
orb2308882 50 µL

Positive Control Lysate for anti- CD80 antibody

Sign In for Pricing
View Details
CBP Cell-Based ELISA
CB6146 1 Kit

CBP Cell-Based ELISA

Sign In for Pricing
View Details