Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-1 (TVBJ1)

This Recombinant Human T cell receptor beta variable 10-1 (TVBJ1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-1 TRBV10-1

UniProt

A0A0K0K1A3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EITQSPRHKITETGRQVTLACHQTWNHNNMFWYRQDLGHGLRLIHYSYGVHDTNKGEVSDGYSVSRSNTEDLPLTLESAASSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal tropomyosin-2 Antibody
NBP1-57612 100 µL

Rabbit Polyclonal tropomyosin-2 Antibody

Sign In for Pricing
View Details
Ube2s sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6234408 1.0 µg DNA

Ube2s sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Rat AFAP1 Protein, His (Fc)-Avi-tagged
AFAP1-209R 50 µg

Recombinant Rat AFAP1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
STFR W021-210x297-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
829438 1 Card (1 Panel (s) x 1 Pack)

STFR W021-210x297-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rhox4a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3250203 1.0 µg DNA

Rhox4a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-PRKCB Antibody (R1K38)
RHC17702 100 μg

Anti-PRKCB Antibody (R1K38)

Sign In for Pricing
View Details