Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-130a-5p miRNA Agomir
abx880536-01 5 nmol

Human hsa-miR-130a-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-130a-5p miRNA Agomir
abx880536-02 10 nmol

Human hsa-miR-130a-5p miRNA Agomir

Sign In for Pricing
View Details
Caspase-6 (CASP6) (NM_032992) Human Tagged Lenti ORF Clone
RC221381L3 10 µg

Caspase-6 (CASP6) (NM_032992) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4'-Chloropivaloanilide
sc-485723 25 g

4'-Chloropivaloanilide

Sign In for Pricing
View Details
Sennoside C
TB0184 10mg

Sennoside C

Sign In for Pricing
View Details
SM16
525292 5.0mg

SM16

Sign In for Pricing
View Details