Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAB21L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
27877154 3x 1.0 µg DNA

MAB21L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
TBC1D10B, CT (TBC1D10B, TBC1 domain family member 10B, Rab27A-GAP-beta) (FITC) discontinued
042628-FITC 200 µL

TBC1D10B, CT (TBC1D10B, TBC1 domain family member 10B, Rab27A-GAP-beta) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Human SERPINB2 Protein
E30P00946A 50 µg

Recombinant Human SERPINB2 Protein

Sign In for Pricing
View Details
MEAF6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV808205 1.0 µg DNA

MEAF6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Melanocyte-stimulating hormone alpha,Alpha-MSH ELISA KIT
JOT-EK3354Hu-01 96 Well

Human Melanocyte-stimulating hormone alpha,Alpha-MSH ELISA KIT

Sign In for Pricing
View Details
Human Melanocyte-stimulating hormone alpha,Alpha-MSH ELISA KIT
JOT-EK3354Hu-02 48 Well

Human Melanocyte-stimulating hormone alpha,Alpha-MSH ELISA KIT

Sign In for Pricing
View Details