Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK2 (NM_020126) Human Recombinant Protein
TP303019 20 µg

SPHK2 (NM_020126) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF431 Rabbit Polyclonal Antibody (Biotin)
orb446725 100 µL

ZNF431 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LENG4 Double Nickase Plasmid (m2)
sc-429544-NIC-2 20 µg

LENG4 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
C8orf85 Protein Vector (Human) (pPB-N-His)
PV066950 500 ng

C8orf85 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mouse Olfactory receptor 488 (Olfr488)
orb2906388-01 20 µg

Recombinant Mouse Olfactory receptor 488 (Olfr488)

Sign In for Pricing
View Details
Recombinant Mouse Olfactory receptor 488 (Olfr488)
orb2906388-02 100 µg

Recombinant Mouse Olfactory receptor 488 (Olfr488)

Sign In for Pricing
View Details