Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIC2 Protein Lysate (Rat) with C-HA Tag
23256036 100 µg

HIC2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Bone Morphogenetic Protein 4 (BMP4) BioAssayTM ECL ELISA Kit (Chicken)
157435 96 Tests

Bone Morphogenetic Protein 4 (BMP4) BioAssayTM ECL ELISA Kit (Chicken)

Sign In for Pricing
View Details
ARHGAP29 siRNA (Rat)
MBS8210893-01 15 nmol

ARHGAP29 siRNA (Rat)

Sign In for Pricing
View Details
ARHGAP29 siRNA (Rat)
MBS8210893-02 30 nmol

ARHGAP29 siRNA (Rat)

Sign In for Pricing
View Details
ARHGAP29 siRNA (Rat)
MBS8210893-03 5x 30 nmol

ARHGAP29 siRNA (Rat)

Sign In for Pricing
View Details
RHOB&RHOA&RHOC Antibody
orb3053165-01 50 µL

RHOB&RHOA&RHOC Antibody

Sign In for Pricing
View Details