Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS705614 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629607 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B8]
TA504807AM 100 µL

Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B8]

Sign In for Pricing
View Details
DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate
LY421202 100 µg

DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate

Sign In for Pricing
View Details
TFIIF (GTF2F1) (NM_002096) Human Over-expression Lysate
LY400767 100 µg

TFIIF (GTF2F1) (NM_002096) Human Over-expression Lysate

Sign In for Pricing
View Details
SMURF1 (NM_181349) Human Recombinant Protein
TP319536L 1 mg

SMURF1 (NM_181349) Human Recombinant Protein

Sign In for Pricing
View Details