Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 (Mono Methyl Arg2) Monoclonal Antibody
AN302117L-01 50 µL

Recombinant Histone H3 (Mono Methyl Arg2) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (Mono Methyl Arg2) Monoclonal Antibody
AN302117L-02 100 µL

Recombinant Histone H3 (Mono Methyl Arg2) Monoclonal Antibody

Sign In for Pricing
View Details
RPL27 (NM_000988) Human Recombinant Protein
TP760581 50 µg

RPL27 (NM_000988) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709253 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF568 conjugate, 0.1mg/mL
BNC683261-500 1x 500 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCR4 Antibody
8C12128-AAT 50 µg

CCR4 Antibody

Sign In for Pricing
View Details