Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INCENP CRISPR Activation Plasmid (h)
sc-403186-ACT 20 µg

INCENP CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anti-Lat Antibody Picoband®, PE Conjugate
A01654-2-PE 100 µg/Vial

Anti-Lat Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Dtwd2 (NM_026854) Mouse Untagged Clone
MC210802 10 µg

Dtwd2 (NM_026854) Mouse Untagged Clone

Sign In for Pricing
View Details
4- (3-Benzyl-thioureido) -benzoic acid
sc-314276 500 mg

4- (3-Benzyl-thioureido) -benzoic acid

Sign In for Pricing
View Details
Vildagliptin
V7950-01 1 g

Vildagliptin

Sign In for Pricing
View Details
Vildagliptin
V7950-02 5 g

Vildagliptin

Sign In for Pricing
View Details